Loading...
Statistics
Eaglepark.com
Eaglepark.com is hosted in
United States
/
Scottsdale
.
Eaglepark.com uses HTTPS protocol.
Number of used technologies:
9.
First technologies:
CSS, Html, Html5,
Number of used javascripts: 8.
First javascripts:
Ajax.js, Jquery.js, Jquery-migrate.min.js,
Number of used analytics tools:
1.
First analytics tools:
Google Analytics,
Number of used plugins, modules: 9.
Its server type is:
Apache/2.4.12.
Its CMS is:
Wordpress.
Technologies in use by Eaglepark.com
Technology
Number of occurences: 9
- CSS
- Html
- Html5
- Javascript
- jQuery
- Lightbox
- Php
- Pingback
- Shortcodes
Advertisement
Javascripts
Number of occurences: 8
- ajax.js
- jquery.js
- jquery-migrate.min.js
- persist.js
- store.js
- ngg_store.js
- anything-popup.js
- lightbox_context.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- Google Analytics
Server Type
- Apache/2.4.12
Powered by
- PHP/5.4.43
Used plugins, modules
Number of plugins and modules: 9
- nextgen gallery
- anything popup
- jquery collapse o matic
- advanced wp columns
- column shortcodes
- featured image zoom
- ajax
- lightbox
- nextgen gallery display
Google Analytics ID
- UA-60682512-1
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Eaglepark.com
SSL certificate
- name: /C=US/ST=Arizona/O=Special Domain Services, LLC/CN=*.prod.phx3.secureserver.net
- subject:
- C: US
- ST: Arizona
- O: Special Domain Services, LLC
- CN: *.prod.phx3.secureserver.net
- hash: 08fc1f03
- issuer:
- C: US
- ST: Arizona
- L: Scottsdale
- O: Starfield Technologies, Inc.
- OU: http://certificates.starfieldtech.com/repository
- CN: Starfield Secure Certification Authority
- serialNumber: 10688435
- version: 2
- serialNumber: 1163043519001003
- validFrom: 140410210610Z
- validTo: 161014170831Z
- validFrom_time_t: 1397163970
- validTo_time_t: 1476464911
- extensions:
- basicConstraints: CA:FALSE
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- keyUsage: Digital Signature, Key Encipherment
- crlDistributionPoints: Full Name: URI:http://crl.starfieldtech.com/sfs2-17.crl
- certificatePolicies: Policy: 2.16.840.1.114414.1.7.23.2 CPS: http://certificates.starfieldtech.com/repository/
- authorityInfoAccess: OCSP - URI:http://ocsp.starfieldtech.com/ CA Issuers - URI:http://certificates.starfieldtech.com/repository/sf_intermediate.crt
- authorityKeyIdentifier: keyid:49:4B:52:27:D1:1B:BC:F2:A1:21:6A:62:7B:51:42:7A:8A:D7:D5:56
- subjectAltName: DNS:*.prod.phx3.secureserver.net, DNS:prod.phx3.secureserver.net
- subjectKeyIdentifier: FC:08:18:6D:14:3A:A7:AA:5D:BF:D1:9A:1B:DE:43:A7:CB:15:65:F0
Number of occurences: 2
- Name:
Content: text/html; charset=UTF-8 - Name: generator
Content: WordPress 4.4.1
Server / Hosting
- IP: 160.153.91.192
- Latitude: 33.61
- Longitude: -111.89
- Country: United States
- City: Scottsdale
Rname
- ns57.domaincontrol.com
- ns58.domaincontrol.com
- mail.eaglepark.com
Target
- dns.jomax.net
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Date: Sat, 30 Apr 2016 04:12:03 GMT
Server: Apache/2.4.12
X-Powered-By: PHP/5.4.43
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Set-Cookie: PHPSESSID=5746894cfdf2f689bfd56faed3d442af; path=/
Location: http://www.eaglepark.com/
Vary: User-Agent
Content-Type: text/html; charset=UTF-8
HTTP/1.1 200 OK
Date: Sat, 30 Apr 2016 04:12:03 GMT
Server: Apache/2.4.12
X-Powered-By: PHP/5.4.43
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: ; rel="https://api.w.org/", ; rel=shortlink
Set-Cookie: PHPSESSID=2e325420df0e82d1fe54fe965d7b75be; path=/
Vary: User-Agent
Content-Type: text/html; charset=UTF-8
DNS
host: eaglepark.com
- class: IN
- ttl: 598
- type: A
- ip: 160.153.91.192
host: eaglepark.com
- class: IN
- ttl: 3600
- type: NS
- target: ns57.domaincontrol.com
host: eaglepark.com
- class: IN
- ttl: 3600
- type: NS
- target: ns58.domaincontrol.com
host: eaglepark.com
- class: IN
- ttl: 3600
- type: SOA
- mname: ns57.domaincontrol.com
- rname: dns.jomax.net
- serial: 2015020601
- refresh: 28800
- retry: 7200
- expire: 604800
- minimum-ttl: 600
host: eaglepark.com
- class: IN
- ttl: 3600
- type: MX
- pri: 0
- target: mail.eaglepark.com
host: eaglepark.com
- class: IN
- ttl: 3600
- type: TXT
- txt: v=spf1 a mx ptr include:secureserver.net ~all
- entries: Array
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.aglepark.com, www.exaglepark.com, www.xaglepark.com, www.esaglepark.com, www.saglepark.com, www.ewaglepark.com, www.waglepark.com, www.eraglepark.com, www.raglepark.com, www.efaglepark.com, www.faglepark.com, www.evaglepark.com, www.vaglepark.com, www.ecaglepark.com, www.caglepark.com, www.eqaglepark.com, www.qaglepark.com, www.eaaglepark.com, www.aaglepark.com, www.eyaglepark.com, www.yaglepark.com, www.eglepark.com, www.eaoglepark.com, www.eoglepark.com, www.eapglepark.com, www.epglepark.com, www.ea9glepark.com, www.e9glepark.com, www.eaglepark.com, www.eglepark.com, www.eaiglepark.com, www.eiglepark.com, www.eauglepark.com, www.euglepark.com, www.ealepark.com, www.eagslepark.com, www.easlepark.com, www.eagxlepark.com, www.eaxlepark.com, www.eagylepark.com, www.eaylepark.com, www.eaghlepark.com, www.eahlepark.com, www.eagnlepark.com, www.eanlepark.com, www.eagclepark.com, www.eaclepark.com, www.eagdlepark.com, www.eadlepark.com, www.eagelepark.com, www.eaelepark.com, www.eagrlepark.com, www.earlepark.com, www.eagtlepark.com, www.eatlepark.com, www.eagblepark.com, www.eablepark.com, www.eagvlepark.com, www.eavlepark.com, www.eagepark.com, www.eagluepark.com, www.eaguepark.com, www.eagl8epark.com, www.eag8epark.com, www.eagl9epark.com, www.eag9epark.com, www.eagljepark.com, www.eagjepark.com, www.eagl0epark.com, www.eag0epark.com, www.eaglmepark.com, www.eagmepark.com, www.eaglpepark.com, www.eagpepark.com, www.eagloepark.com, www.eagoepark.com, www.eaglpark.com, www.eaglexpark.com, www.eaglxpark.com, www.eaglespark.com, www.eaglspark.com, www.eaglewpark.com, www.eaglwpark.com, www.eaglerpark.com, www.eaglrpark.com, www.eaglefpark.com, www.eaglfpark.com, www.eaglevpark.com, www.eaglvpark.com, www.eaglecpark.com, www.eaglcpark.com, www.eagleqpark.com, www.eaglqpark.com, www.eagleapark.com, www.eaglapark.com, www.eagleypark.com, www.eaglypark.com, www.eagleark.com, www.eaglepiark.com, www.eagleiark.com, www.eaglepkark.com, www.eaglekark.com, www.eaglepuark.com, www.eagleuark.com, www.eaglepjark.com, www.eaglejark.com, www.eagleplark.com, www.eaglelark.com, www.eagleprk.com, www.eaglepaork.com, www.eaglepork.com, www.eaglepaprk.com, www.eaglepprk.com, www.eaglepa9rk.com, www.eaglep9rk.com, www.eaglepark.com, www.eagleprk.com, www.eaglepairk.com, www.eaglepirk.com, www.eaglepaurk.com, www.eaglepurk.com, www.eaglepak.com, www.eagleparik.com, www.eaglepaik.com, www.eagleparok.com, www.eaglepaok.com, www.eagleparlk.com, www.eaglepalk.com, www.eagleparlk.com, www.eaglepalk.com, www.eaglepar.k.com, www.eaglepa.k.com, www.eaglepar.com, www.eagleparkt.com, www.eaglepart.com, www.eaglepark.com, www.eaglepar.com, www.eagleparkg.com, www.eagleparg.com, www.eagleparkb.com, www.eagleparb.com, www.eagleparkn.com, www.eagleparn.com, www.eagleparkh.com, www.eagleparh.com, www.eagleparky.com, www.eaglepary.com, www.eagleparkl.com, www.eagleparl.com, www.eagleparko.com, www.eagleparo.com, www.eagleparku.com, www.eagleparu.com, www.eagleparki.com, www.eaglepari.com, www.eagleparkm.com, www.eagleparm.com,
Other websites we recently analyzed
- Mechler Family
Provo (United States) - 74.220.215.239
Server software: nginx/1.10.1
Technology: CSS, Javascript, Php
Number of Javascript: 3
Number of meta tags: 4 - é’岛最好的人æµåŒ»é™¢_é’岛红房å妇科医院ã€å®˜ç½‘挂å·ã€‘
★é’岛红房å妇科医院，é’岛最好的人æµåŒ»é™¢â˜…作为é’岛红房å医院人æµæ‰‹æœ¯æŠ€æœ¯å…ˆè¿›,是é’岛公认的人æµåŒ»é™¢ã€‚是患者值得信赖的好医院ï¼å’¨è¯¢ç”µè¯ï¼š15689963690Ottawa (Canada) - 47.88.22.245
Server software: Apache
Technology: CSS, Html, Javascript, jQuery
Number of Javascript: 9
Number of meta tags: 6 - OurRoadWedding | Otro sitio realizado con WordPress
Germany - 212.227.247.198
Server software: Apache
Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Revslider, Wordpress
Number of Javascript: 17
Number of meta tags: 4 - Tom Weller Presents
Berkeley (United States) - 66.117.151.35
Server software: Apache
Technology: Html - wartwood.ru
Russian Federation - 31.31.204.59
Server software: nginx
Technology: CSS, Html, Html5
Number of Javascript: 3
Number of meta tags: 2 - putabirdonit
Brea (United States) - 69.163.153.119
Server software: Apache
Technology: Html, Html5, Javascript
Number of Javascript: 1
Number of meta tags: 2 - pleasegivewillyapleasemaamsir.biz
Scottsdale (United States) - 50.63.202.45
Server software: Microsoft-IIS/7.5
Technology: Html, Html5, Iframe - TXMayday Enterprises - Airplane enginees, parts
The web-based aircraft parts locater system, marketplace and business network for the aviation industry. We bring buyers and sellers together - global, fast and effectiveScottsdale (United States) - 50.63.196.46
Server software: Microsoft-IIS/7.0
Technology: CSS, Html, Javascript, Php
Number of Javascript: 5
Number of meta tags: 5 - spherepr.net
Australia - 202.124.241.178
Server software: Redirector - NetRegistry Pty Ltd
Technology: Html
Number of meta tags: 2 - kmlsny.com
San Jose (United States) - 69.46.84.52
Server software: Tengine/1.4.2
Technology: Google Adsense, Html, Javascript, Php
Number of Javascript: 2
Number of meta tags: 1